PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G11840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 579aa    MW: 61160.6 Da    PI: 4.9153
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G11840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.37.7e-911325291373
             GRAS   1 lvelLlecAeavss..gdlelaqalLarlselaspdgd......pmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfs 85 
                      l +lL+++Aea+s   ++ ela+ +L rl+e++s ++       +m+Rlaa+ft AL+  l +s +   +  ++ ++++++   ++l+a+++++
  ORUFI03G11840.1 132 LLHLLMAAAEALSGphKSRELARVILVRLKEMVSHTAGanaaasNMERLAAHFTDALQGLLDGSHPVGGSGRQAAAAASHHhAGDVLTAFQMLQ 225
                      579**********8557777************7766544566669******************888777766555554444499********** PP

             GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                      ++sP++kf+h+taNqaIleav+g++rvHi+D+di +G+QW++L+qa++sR+   ++p+lRiT+v+++  g +++++e g+rL+ fA+++g pf+
  ORUFI03G11840.1 226 DMSPYMKFGHFTANQAILEAVSGDRRVHIVDYDIAEGIQWASLMQAMTSRAdgVPAPHLRITAVSRSGGGGARAVQEAGRRLSAFAASIGQPFS 319
                      ***************************************************666789*********7777************************ PP

             GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnse................sFl 254
                      f     ++ e +++ + r+ +gEal+ n+vl+                 ++L+ +  l +k+v+vve+e + ++                  F+
  ORUFI03G11840.1 320 FGQCRLDSDERFRPATVRMVKGEALVANCVLHQAAATTTIRRP-TgSVASFLSGMAALGAKLVTVVEEEGEAEKDddgdsagdaaaaaaagGFV 412
                      ***9999***********************9655554333333.247889*******************98866568999************** PP

             GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                      +rf+e l+ ysa+ dslea++p++s+ r  vEr++l+++i  +v+ + +    + e    W ++++ +GF++vpls ++ +qa+lll  ++ dg
  ORUFI03G11840.1 413 RRFMEELHRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRG--VDGEGRCGWGQWMRGSGFTAVPLSCFNHSQARLLLGLFN-DG 503
                      *********************************************99887..88899999*******************************.** PP

             GRAS 349 yrveee.sgslvlgWkdrpLvsvSaW 373
                      y+vee   + +vlgWk r+L+s+S+W
  ORUFI03G11840.1 504 YTVEETgPNKIVLGWKARRLMSASVW 529
                      ****99457788************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.874106510IPR005202Transcription factor GRAS
PfamPF035142.7E-88132529IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MEVTMEDVAG DFEFSGCGST TTTSSASSLD DGTGMCYAWG ELSPVADWAN FCCSDDDGGH  60
DLHGLIESML CDDTLVGVDD DGQAGLHHTD MFRDDLYCYG NGSNPSSTTT TNPGSPVFDD  120
PTQGCPEKGL RLLHLLMAAA EALSGPHKSR ELARVILVRL KEMVSHTAGA NAAASNMERL  180
AAHFTDALQG LLDGSHPVGG SGRQAAAAAS HHHAGDVLTA FQMLQDMSPY MKFGHFTANQ  240
AILEAVSGDR RVHIVDYDIA EGIQWASLMQ AMTSRADGVP APHLRITAVS RSGGGGARAV  300
QEAGRRLSAF AASIGQPFSF GQCRLDSDER FRPATVRMVK GEALVANCVL HQAAATTTIR  360
RPTGSVASFL SGMAALGAKL VTVVEEEGEA EKDDDGDSAG DAAAAAAAGG FVRRFMEELH  420
RYSAVWDSLE AGFPTQSRVR GLVERVILAP NIAGAVSRAY RGVDGEGRCG WGQWMRGSGF  480
TAVPLSCFNH SQARLLLGLF NDGYTVEETG PNKIVLGWKA RRLMSASVWA PPPLPVPSSP  540
PEGVCQPVVG MAPVATGGFA RTEFDYIDSF LVEPAYALV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3716252925374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630025.10.0PREDICTED: nodulation-signaling pathway 2 protein-like
SwissprotQ5NE241e-153NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLA0A0E0NST60.0A0A0E0NST6_ORYRU; Uncharacterized protein
STRINGBGIOSGA012273-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75803148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.13e-98GRAS family protein